IVList
Find IV Therapy

NAD+ IV Therapy in Lakeland, Florida

Cellular energy, DNA repair, and longevity

Medically reviewed by Jonathan Belmore, MD|Updated 2026-06-01
$275 – $545 per session~90 minutesLakeland, FL
Book in Lakeland

NAD+ IV Therapy in Lakeland

IVList lists 8 providers offering NAD+ IV therapy in Lakeland, Florida — including Sage Infusion Lakeland, Enhanced Lifestyle Healthcare IV Therapy and Spa, Medic-One Infusions. All are in-clinic locations, with an average rating of 5★ across local reviews. Compare pricing and book NAD+ below.

With a population of 290,540, Lakeland has a growing IV therapy market. 8 local providers offer treatments including hangover recovery, Myers' Cocktail, NAD+ infusions, and hydration drips. IV therapy sessions in Lakeland typically range from $99 to $500 depending on the treatment. Visit a local IV clinic in Polk County for your session.

What is NAD+ IV Therapy?

NAD+ (nicotinamide adenine dinucleotide) is a coenzyme present in every cell, essential for energy metabolism, DNA repair, and the activation of longevity proteins called sirtuins. NAD+ levels decline 50%+ by middle age. IV NAD+ therapy delivers this critical molecule directly to cells at concentrations impossible to achieve orally, supporting cellular regeneration, cognitive function, and anti-aging pathways.

Key Benefits

  • Enhanced cellular energy
  • DNA repair activation
  • Sirtuin (longevity protein) activation
  • Improved cognitive clarity
  • Mood and mental health support
  • Athletic performance
  • Addiction recovery support

Best For

  • Anti-aging and longevity
  • Cognitive performance
  • Chronic fatigue syndrome
  • Athletic recovery
  • Addiction recovery support
  • Neurological health
  • Biohackers and longevity enthusiasts

NAD+ Pricing in Lakeland

Local pricing estimates based on market data for Lakeland, Florida.

Starting From

$275

Typical High

$545

Session Length

90 min

Prices vary by provider, add-ons, and mobile vs. clinic delivery. Mobile services may add a $25–$50 travel fee.

What's in a NAD+ IV Drip?

NAD+ (Nicotinamide Adenine Dinucleotide)Normal SalineOptional: B-ComplexOptional: Amino Acids

NAD+ IV Providers in Lakeland

8 listed

Sage Infusion Lakeland

Medical Clinic
5.0(14 reviews)
1961 E Edgewood Dr suite 102, Lakeland, FL 33803
(863) 777-2528
sageinfusion.com/location/sage-infusion-lakeland-coming-soon/

Drips Available

hydrationmyers-cocktailhangoverimmunityvitamin-c+5 more
Book IV Session

Enhanced Lifestyle Healthcare IV Therapy and Spa

IV Bar
5.0(13 reviews)
2125 Harden Blvd, Lakeland, FL 33803
(863) 222-4060
enhancedlifestylespa.com/

Drips Available

hydrationmyers-cocktailhangoverimmunityvitamin-c+3 more
Book IV Session

Medic-One Infusions

IV Bar
5.0(9 reviews)
6609 N Socrum Loop Rd, Lakeland, FL 33809
(863) 333-0119
mediconeinfusions.com/

Drips Available

hydrationmyers-cocktailhangoverimmunityvitamin-c+3 more
Book IV Session

Serenity Mind and Body Solutions | MedSpa and Wellness Clinic Lakeland FL

Wellness Center
5.0(48 reviews)
5143 S Lakeland Dr #2, Lakeland, FL 33813
(863) 900-2081
medspaandwellnesscliniclakelandfl.com/

Drips Available

hydrationmyers-cocktailhangoverimmunityvitamin-c+3 more
Book IV Session

Dr. Fusion IV Therapy & Wellness

Wellness Center
5.0(29 reviews)
100 S Kentucky Ave Suite 255, Lakeland, FL 33801
(863) 209-7282
driploungebydrfusion.com/

Drips Available

hydrationmyers-cocktailhangoverimmunityvitamin-c+3 more
Book IV Session

Cisne Wellness

Medical Clinic
5.0(103 reviews)
2026 E County Rd 540A, Lakeland, FL 33813
(863) 825-2005
mdl-spa.com/

Drips Available

hydrationmyers-cocktailhangoverimmunityvitamin-c+5 more
Book IV Session

LIVE Hydration Spa Lakeland

IV Bar
5.0(133 reviews)
4664 E County Rd 540A, Lakeland, FL 33813
(863) 940-2032
locations.livehydrationspa.com/fl/lakeland/lakeland.html

Drips Available

hydrationmyers-cocktailhangoverimmunityvitamin-c+3 more
Book IV Session

IVX Health Infusion Center

Medical Clinic
4.9(54 reviews)
919 Lakeland Park Center Dr Suite 374, Lakeland, FL 33809
(863) 316-3900
ivxhealth.com/locations/florida/lakeland-park?utm_source=extnet&utm_medium=yext

Drips Available

hydrationmyers-cocktailhangoverimmunityvitamin-c+5 more
Book IV Session

FAQ — NAD+ IV Therapy in Lakeland

NAD+ IV therapy in Lakeland, Florida typically costs $275–$545 per session. That range reflects the 8 Lakeland providers offering NAD+ in our directory. Mobile visits usually add a $25–$50 travel fee, and add-ons or multi-session packages can change the total.
IVList lists 8 Lakeland providers offering NAD+, including Sage Infusion Lakeland. Most operate as in-clinic locations in and around Lakeland. Listed Lakeland providers average 5★ in reviews. Compare them on this page and request a quote to get matched.
A NAD+ IV session in Lakeland typically takes about 90 minutes, plus 10–15 minutes for intake at your first visit.
NAD+ is most often used for Anti-aging and longevity, Cognitive performance, Chronic fatigue syndrome, Athletic recovery. NAD+ (nicotinamide adenine dinucleotide) is a coenzyme present in every cell, essential for energy metabolism, DNA repair, and the activation of longevity proteins called sirtuins.
NAD+ IV therapy is generally safe when administered by a licensed RN or NP at a reputable Lakeland provider operating under a medical director. It may not be appropriate for people with Active cancer (consult oncologist), Pregnancy, Severe liver disease — always complete a health intake first.
Our current Lakeland listings for NAD+ are in-clinic, but mobile IV service is expanding across Florida. Ask local providers about home or hotel delivery, which usually adds a $25–$50 travel fee.

Find IV Therapy Providers in Lakeland

Compare local clinics and mobile IV services. Free, no-obligation quotes.

✓ Free service✓ No spam✓ Licensed providers only