IVList
List BusinessFind IV

NAD+ IV Therapy in Lakeland, Florida

Cellular energy, DNA repair, and longevity

Medically reviewed by Jonathan Belmore, MD|Updated 2026-06-01
$275 – $545 per session~90 minutesLakeland, FL
Book in Lakeland

NAD+ IV Therapy in Lakeland

IVList lists 8 providers offering NAD+ IV therapy in Lakeland, Florida — including Sage Infusion Lakeland, Enhanced Lifestyle Healthcare IV Therapy and Spa, Medic-One Infusions. All are in-clinic locations, with an average rating of 5★ across local reviews. Compare pricing and book NAD+ below.

With a population of 290,540, Lakeland has a growing IV therapy market. 8 local providers offer treatments including hangover recovery, Myers' Cocktail, NAD+ infusions, and hydration drips. IV therapy sessions in Lakeland typically range from $99 to $500 depending on the treatment. Visit a local IV clinic in Polk County for your session.

What is NAD+ IV Therapy?

NAD+ (nicotinamide adenine dinucleotide) is a coenzyme present in every cell, essential for energy metabolism, DNA repair, and the activation of longevity proteins called sirtuins. NAD+ levels decline 50%+ by middle age. IV NAD+ therapy delivers this critical molecule directly to cells at concentrations impossible to achieve orally, supporting cellular regeneration, cognitive function, and anti-aging pathways.

Key Benefits

  • Enhanced cellular energy
  • DNA repair activation
  • Sirtuin (longevity protein) activation
  • Improved cognitive clarity
  • Mood and mental health support
  • Athletic performance
  • Addiction recovery support

Best For

  • Anti-aging and longevity
  • Cognitive performance
  • Chronic fatigue syndrome
  • Athletic recovery
  • Addiction recovery support
  • Neurological health
  • Biohackers and longevity enthusiasts

NAD+ Pricing in Lakeland

Local pricing estimates based on market data for Lakeland, Florida.

Starting From

$275

Typical High

$545

Session Length

90 min

Prices vary by provider, add-ons, and mobile vs. clinic delivery. Mobile services may add a $25–$50 travel fee.

What's in a NAD+ IV Drip?

NAD+ (Nicotinamide Adenine Dinucleotide)Normal SalineOptional: B-ComplexOptional: Amino Acids

NAD+ IV Providers in Lakeland

8 listed

Sage Infusion Lakeland

Medical Clinic
5.0(14 reviews)
1961 E Edgewood Dr suite 102, Lakeland, FL 33803
(863) 777-2528
sageinfusion.com/location/sage-infusion-lakeland-coming-soon/

Drips Available

hydrationmyers-cocktailhangoverimmunityvitamin-c+5 more
Book IV Session

Enhanced Lifestyle Healthcare IV Therapy and Spa

IV Bar
5.0(13 reviews)
2125 Harden Blvd, Lakeland, FL 33803
(863) 222-4060
enhancedlifestylespa.com/

Drips Available

hydrationmyers-cocktailhangoverimmunityvitamin-c+3 more
Book IV Session

Medic-One Infusions

IV Bar
5.0(9 reviews)
6609 N Socrum Loop Rd, Lakeland, FL 33809
(863) 333-0119
mediconeinfusions.com/

Drips Available

hydrationmyers-cocktailhangoverimmunityvitamin-c+3 more
Book IV Session

Serenity Mind and Body Solutions | MedSpa and Wellness Clinic Lakeland FL

Wellness Center
5.0(48 reviews)
5143 S Lakeland Dr #2, Lakeland, FL 33813
(863) 900-2081
medspaandwellnesscliniclakelandfl.com/

Drips Available

hydrationmyers-cocktailhangoverimmunityvitamin-c+3 more
Book IV Session

Dr. Fusion IV Therapy & Wellness

Wellness Center
5.0(29 reviews)
100 S Kentucky Ave Suite 255, Lakeland, FL 33801
(863) 209-7282
driploungebydrfusion.com/

Drips Available

hydrationmyers-cocktailhangoverimmunityvitamin-c+3 more
Book IV Session

Cisne Wellness

Medical Clinic
5.0(103 reviews)
2026 E County Rd 540A, Lakeland, FL 33813
(863) 825-2005
mdl-spa.com/

Drips Available

hydrationmyers-cocktailhangoverimmunityvitamin-c+5 more
Book IV Session

LIVE Hydration Spa Lakeland

IV Bar
5.0(133 reviews)
4664 E County Rd 540A, Lakeland, FL 33813
(863) 940-2032
locations.livehydrationspa.com/fl/lakeland/lakeland.html

Drips Available

hydrationmyers-cocktailhangoverimmunityvitamin-c+3 more
Book IV Session

IVX Health Infusion Center

Medical Clinic
4.9(54 reviews)
919 Lakeland Park Center Dr Suite 374, Lakeland, FL 33809
(863) 316-3900
ivxhealth.com/locations/florida/lakeland-park?utm_source=extnet&utm_medium=yext

Drips Available

hydrationmyers-cocktailhangoverimmunityvitamin-c+5 more
Book IV Session

FAQ — NAD+ IV Therapy in Lakeland

NAD+ IV therapy in Lakeland, Florida typically costs $275–$545 per session. That range reflects the 8 Lakeland providers offering NAD+ in our directory. Mobile visits usually add a $25–$50 travel fee, and add-ons or multi-session packages can change the total.
IVList lists 8 Lakeland providers offering NAD+, including Sage Infusion Lakeland. Most operate as in-clinic locations in and around Lakeland. Listed Lakeland providers average 5★ in reviews. Compare them on this page and request a quote to get matched.
A NAD+ IV session in Lakeland typically takes about 90 minutes, plus 10–15 minutes for intake at your first visit.
NAD+ is most often used for Anti-aging and longevity, Cognitive performance, Chronic fatigue syndrome, Athletic recovery. NAD+ (nicotinamide adenine dinucleotide) is a coenzyme present in every cell, essential for energy metabolism, DNA repair, and the activation of longevity proteins called sirtuins.
NAD+ IV therapy is generally safe when administered by a licensed RN or NP at a reputable Lakeland provider operating under a medical director. It may not be appropriate for people with Active cancer (consult oncologist), Pregnancy, Severe liver disease — always complete a health intake first.
Our current Lakeland listings for NAD+ are in-clinic, but mobile IV service is expanding across Florida. Ask local providers about home or hotel delivery, which usually adds a $25–$50 travel fee.

Find IV Therapy Providers in Lakeland

Compare local clinics and mobile IV services. Free, no-obligation quotes.

Where would you like treatment? *

By submitting this form, you agree that IVList may share the information you provide with IV therapy providers in your area, and that those providers may contact you by phone, text message, or email about your request. Consent is not a condition of purchase, and message/data rates may apply. See our Privacy Policy.

✓ Free service✓ No obligation✓ Licensed providers only